Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045268-25

• 
• 
• 

Protein Description: chromosome 9 open reading frame 142
Gene Name: C9orf142
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047617: 78%, ENSRNOG00000015294: 79%
Entrez Gene ID: 286257
Uniprot ID: Q9BUH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET
• Gene Sequence: LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET
• Gene ID - Mouse: ENSMUSG00000047617
• Gene ID - Rat: ENSRNOG00000015294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) – 1 Found

Craxton, Andrew; Munnur, Deeksha; Jukes-Jones, Rebekah; Skalka, George; Langlais, Claudia; Cain, Kelvin; Malewicz, Michal. PAXX and its paralogs synergistically direct DNA polymerase λ activity in DNA repair. Nature Communications. 2018;9(1):3877.