Protein Description: chromosome 9 open reading frame 116
Gene Name: C9orf116
Alternative Gene Name: MGC29761, PIERCE1, RbEST47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026831: 58%, ENSRNOG00000010152: 70%
Entrez Gene ID: 138162
Uniprot ID: Q5BN46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C9orf116
Alternative Gene Name: MGC29761, PIERCE1, RbEST47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026831: 58%, ENSRNOG00000010152: 70%
Entrez Gene ID: 138162
Uniprot ID: Q5BN46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN |
| Documents & Links for Anti C9orf116 pAb (ATL-HPA065287) | |
| Datasheet | Anti C9orf116 pAb (ATL-HPA065287) Datasheet (External Link) |
| Vendor Page | Anti C9orf116 pAb (ATL-HPA065287) at Atlas |
| Documents & Links for Anti C9orf116 pAb (ATL-HPA065287) | |
| Datasheet | Anti C9orf116 pAb (ATL-HPA065287) Datasheet (External Link) |
| Vendor Page | Anti C9orf116 pAb (ATL-HPA065287) |