Anti C8orf46 pAb (ATL-HPA075134)

Atlas Antibodies

SKU: ATL-HPA075134-25

• 

Protein Description: chromosome 8 open reading frame 46
Gene Name: C8orf46
Alternative Gene Name: MGC33510
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067879: 98%, ENSRNOG00000021663: 100%
Entrez Gene ID: 254778
Uniprot ID: Q8TAG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEA
• Gene Sequence: QGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEA
• Gene ID - Mouse: ENSMUSG00000067879
• Gene ID - Rat: ENSRNOG00000021663
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.