Protein Description: chromosome 8 open reading frame 46
Gene Name: C8orf46
Alternative Gene Name: MGC33510
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067879: 98%, ENSRNOG00000021663: 100%
Entrez Gene ID: 254778
Uniprot ID: Q8TAG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C8orf46
Alternative Gene Name: MGC33510
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067879: 98%, ENSRNOG00000021663: 100%
Entrez Gene ID: 254778
Uniprot ID: Q8TAG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEA |
| Documents & Links for Anti C8orf46 pAb (ATL-HPA075134) | |
| Datasheet | Anti C8orf46 pAb (ATL-HPA075134) Datasheet (External Link) |
| Vendor Page | Anti C8orf46 pAb (ATL-HPA075134) at Atlas |
| Documents & Links for Anti C8orf46 pAb (ATL-HPA075134) | |
| Datasheet | Anti C8orf46 pAb (ATL-HPA075134) Datasheet (External Link) |
| Vendor Page | Anti C8orf46 pAb (ATL-HPA075134) |