Anti C8orf34 pAb (ATL-HPA053065)

Atlas Antibodies

SKU:
ATL-HPA053065-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 34
Gene Name: C8orf34
Alternative Gene Name: vest-1, VEST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057715: 92%, ENSRNOG00000005375: 91%
Entrez Gene ID: 116328
Uniprot ID: Q49A92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQ
Gene Sequence LGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQ
Gene ID - Mouse ENSMUSG00000057715
Gene ID - Rat ENSRNOG00000005375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C8orf34 pAb (ATL-HPA053065)
Datasheet Anti C8orf34 pAb (ATL-HPA053065) Datasheet (External Link)
Vendor Page Anti C8orf34 pAb (ATL-HPA053065) at Atlas Antibodies

Documents & Links for Anti C8orf34 pAb (ATL-HPA053065)
Datasheet Anti C8orf34 pAb (ATL-HPA053065) Datasheet (External Link)
Vendor Page Anti C8orf34 pAb (ATL-HPA053065)