Anti C7orf26 pAb (ATL-HPA052175)

Atlas Antibodies

SKU:
ATL-HPA052175-25
  • Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 7 open reading frame 26
Gene Name: C7orf26
Alternative Gene Name: MGC2718
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039244: 96%, ENSRNOG00000024567: 52%
Entrez Gene ID: 79034
Uniprot ID: Q96N11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSM
Gene Sequence AKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSM
Gene ID - Mouse ENSMUSG00000039244
Gene ID - Rat ENSRNOG00000024567
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C7orf26 pAb (ATL-HPA052175)
Datasheet Anti C7orf26 pAb (ATL-HPA052175) Datasheet (External Link)
Vendor Page Anti C7orf26 pAb (ATL-HPA052175) at Atlas Antibodies

Documents & Links for Anti C7orf26 pAb (ATL-HPA052175)
Datasheet Anti C7orf26 pAb (ATL-HPA052175) Datasheet (External Link)
Vendor Page Anti C7orf26 pAb (ATL-HPA052175)