Anti C6orf47 pAb (ATL-HPA045281)

Atlas Antibodies

SKU: ATL-HPA045281-25

• 
• 
• 

Protein Description: chromosome 6 open reading frame 47
Gene Name: C6orf47
Alternative Gene Name: D6S53E, G4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043311: 58%, ENSRNOG00000039658: 59%
Entrez Gene ID: 57827
Uniprot ID: O95873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHVDSGGTRRPGVSPEGGLSVPGPGAPLEK
• Gene Sequence: EPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHVDSGGTRRPGVSPEGGLSVPGPGAPLEK
• Gene ID - Mouse: ENSMUSG00000043311
• Gene ID - Rat: ENSRNOG00000039658
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.