Anti C6orf226 pAb (ATL-HPA045350 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045350-25
  • Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells and ganglion.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C6orf226 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423367).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 6 open reading frame 226
Gene Name: C6orf226
Alternative Gene Name: LOC441150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062619: 55%, ENSRNOG00000046871: 50%
Entrez Gene ID: 441150
Uniprot ID: Q5I0X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVG
Gene Sequence ASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVG
Gene ID - Mouse ENSMUSG00000062619
Gene ID - Rat ENSRNOG00000046871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C6orf226 pAb (ATL-HPA045350 w/enhanced validation)
Datasheet Anti C6orf226 pAb (ATL-HPA045350 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C6orf226 pAb (ATL-HPA045350 w/enhanced validation)