Anti C6orf223 pAb (ATL-HPA046117)

Atlas Antibodies

SKU: ATL-HPA046117-25

• 

Protein Description: chromosome 6 open reading frame 223
Gene Name: C6orf223
Alternative Gene Name: MGC45491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 28%, ENSRNOG00000013642: 28%
Entrez Gene ID: 221416
Uniprot ID: Q8N319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE
• Gene Sequence: MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE
• Gene ID - Mouse: ENSMUSG00000006403
• Gene ID - Rat: ENSRNOG00000013642
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.