Anti C6orf222 pAb (ATL-HPA058189)

Atlas Antibodies

SKU: ATL-HPA058189-25

• 

Protein Description: chromosome 6 open reading frame 222
Gene Name: C6orf222
Alternative Gene Name: DKFZp779B1540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048905: 56%, ENSRNOG00000048914: 25%
Entrez Gene ID: 389384
Uniprot ID: P0C671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGACESKEIIIQKLVALLQEVDGQLGQQIRRHPSFKRFFYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAM
• Gene Sequence: SGACESKEIIIQKLVALLQEVDGQLGQQIRRHPSFKRFFYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAM
• Gene ID - Mouse: ENSMUSG00000048905
• Gene ID - Rat: ENSRNOG00000048914
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.