Anti C6orf203 pAb (ATL-HPA049535)
Atlas Antibodies
- SKU:
- ATL-HPA049535-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C6orf203
Alternative Gene Name: HSPC230, PRED31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019797: 78%, ENSRNOG00000047118: 78%
Entrez Gene ID: 51250
Uniprot ID: Q9P0P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK |
| Gene Sequence | VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK |
| Gene ID - Mouse | ENSMUSG00000019797 |
| Gene ID - Rat | ENSRNOG00000047118 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C6orf203 pAb (ATL-HPA049535) | |
| Datasheet | Anti C6orf203 pAb (ATL-HPA049535) Datasheet (External Link) |
| Vendor Page | Anti C6orf203 pAb (ATL-HPA049535) at Atlas Antibodies |
| Documents & Links for Anti C6orf203 pAb (ATL-HPA049535) | |
| Datasheet | Anti C6orf203 pAb (ATL-HPA049535) Datasheet (External Link) |
| Vendor Page | Anti C6orf203 pAb (ATL-HPA049535) |
| Citations for Anti C6orf203 pAb (ATL-HPA049535) – 1 Found |
| Ng, Kah Ying; Lutfullahoglu Bal, Guleycan; Richter, Uwe; Safronov, Omid; Paulin, Lars; Dunn, Cory D; Paavilainen, Ville O; Richer, Julie; Newman, William G; Taylor, Robert W; Battersby, Brendan J. Nonstop mRNAs generate a ground state of mitochondrial gene expression noise. Science Advances. 2022;8(46):eabq5234. PubMed |