Anti C6orf136 pAb (ATL-HPA046804)

Atlas Antibodies

SKU: ATL-HPA046804-25

• 

Protein Description: chromosome 6 open reading frame 136
Gene Name: C6orf136
Alternative Gene Name: Em:AB023049.8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050705: 82%, ENSRNOG00000000812: 81%
Entrez Gene ID: 221545
Uniprot ID: Q5SQH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDV
• Gene Sequence: EGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDV
• Gene ID - Mouse: ENSMUSG00000050705
• Gene ID - Rat: ENSRNOG00000000812
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.