Anti C5AR1 pAb (ATL-HPA048012)

Atlas Antibodies

SKU: ATL-HPA048012-25

• 

Protein Description: complement C5a receptor 1
Gene Name: C5AR1
Alternative Gene Name: C5A, C5AR, C5R1, CD88
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015474: 36%, ENSRNOG00000011022: 36%
Entrez Gene ID: 728
Uniprot ID: P21730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI
• Gene Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI
• Gene ID - Mouse: ENSMUSG00000015474
• Gene ID - Rat: ENSRNOG00000011022
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.