Anti C4orf46 pAb (ATL-HPA047287)

Atlas Antibodies

SKU: ATL-HPA047287-25

• 

Protein Description: chromosome 4 open reading frame 46
Gene Name: C4orf46
Alternative Gene Name: LOC201725, RCDG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027811: 94%, ENSRNOG00000010071: 94%
Entrez Gene ID: 201725
Uniprot ID: Q504U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
• Gene Sequence: QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
• Gene ID - Mouse: ENSMUSG00000027811
• Gene ID - Rat: ENSRNOG00000010071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.