Anti C4orf46 pAb (ATL-HPA047287)
Atlas Antibodies
- SKU:
- ATL-HPA047287-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C4orf46
Alternative Gene Name: LOC201725, RCDG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027811: 94%, ENSRNOG00000010071: 94%
Entrez Gene ID: 201725
Uniprot ID: Q504U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD |
Gene Sequence | QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD |
Gene ID - Mouse | ENSMUSG00000027811 |
Gene ID - Rat | ENSRNOG00000010071 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C4orf46 pAb (ATL-HPA047287) | |
Datasheet | Anti C4orf46 pAb (ATL-HPA047287) Datasheet (External Link) |
Vendor Page | Anti C4orf46 pAb (ATL-HPA047287) at Atlas Antibodies |
Documents & Links for Anti C4orf46 pAb (ATL-HPA047287) | |
Datasheet | Anti C4orf46 pAb (ATL-HPA047287) Datasheet (External Link) |
Vendor Page | Anti C4orf46 pAb (ATL-HPA047287) |