Anti C4orf19 pAb (ATL-HPA052894)

Atlas Antibodies

SKU: ATL-HPA052894-25

• 

Protein Description: chromosome 4 open reading frame 19
Gene Name: C4orf19
Alternative Gene Name: FLJ11017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060512: 51%, ENSRNOG00000002191: 51%
Entrez Gene ID: 55286
Uniprot ID: Q8IY42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH
• Gene Sequence: TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH
• Gene ID - Mouse: ENSMUSG00000060512
• Gene ID - Rat: ENSRNOG00000002191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.