Anti C4orf17 pAb (ATL-HPA060564)

Atlas Antibodies

SKU:
ATL-HPA060564-25
  • Immunohistochemical staining of human fallopian tube shows strong membranous positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Testis tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 17
Gene Name: C4orf17
Alternative Gene Name: DKFZP434G072
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012042: 37%, ENSRNOG00000024623: 52%
Entrez Gene ID: 84103
Uniprot ID: Q53FE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IMARNVSCFLVRHTPHPRRVCHIKGLNNIPICTVNDDENAFGTLWGVGQSNYLEKNRIPFANCSYPSSTAVQESPVRGMSPAPNGAKVP
Gene Sequence IMARNVSCFLVRHTPHPRRVCHIKGLNNIPICTVNDDENAFGTLWGVGQSNYLEKNRIPFANCSYPSSTAVQESPVRGMSPAPNGAKVP
Gene ID - Mouse ENSMUSG00000012042
Gene ID - Rat ENSRNOG00000024623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C4orf17 pAb (ATL-HPA060564)
Datasheet Anti C4orf17 pAb (ATL-HPA060564) Datasheet (External Link)
Vendor Page Anti C4orf17 pAb (ATL-HPA060564) at Atlas Antibodies

Documents & Links for Anti C4orf17 pAb (ATL-HPA060564)
Datasheet Anti C4orf17 pAb (ATL-HPA060564) Datasheet (External Link)
Vendor Page Anti C4orf17 pAb (ATL-HPA060564)