Anti C4A pAb (ATL-HPA046356)

Atlas Antibodies

SKU:
ATL-HPA046356-25
  • Immunohistochemical staining of human urinary bladder shows positivity in plasma.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: complement component 4A (Rodgers blood group)
Gene Name: C4A
Alternative Gene Name: C4, C4A2, C4A3, C4A4, C4A6, C4B, C4S, CO4, CPAMD2, RG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073418: 69%, ENSRNOG00000000443: 72%
Entrez Gene ID: 720
Uniprot ID: P0C0L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEI
Gene Sequence SCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEI
Gene ID - Mouse ENSMUSG00000073418
Gene ID - Rat ENSRNOG00000000443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C4A pAb (ATL-HPA046356)
Datasheet Anti C4A pAb (ATL-HPA046356) Datasheet (External Link)
Vendor Page Anti C4A pAb (ATL-HPA046356) at Atlas Antibodies

Documents & Links for Anti C4A pAb (ATL-HPA046356)
Datasheet Anti C4A pAb (ATL-HPA046356) Datasheet (External Link)
Vendor Page Anti C4A pAb (ATL-HPA046356)



Citations for Anti C4A pAb (ATL-HPA046356) – 2 Found
Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79.  PubMed
Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517.  PubMed