Anti C3orf36 pAb (ATL-HPA046432)

Atlas Antibodies

SKU: ATL-HPA046432-25

• 

Protein Description: chromosome 3 open reading frame 36
Gene Name: C3orf36
Alternative Gene Name: FLJ22173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048154: 37%, ENSRNOG00000061499: 37%
Entrez Gene ID: 80111
Uniprot ID: Q3SXR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRLSPP
• Gene Sequence: PGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRLSPP
• Gene ID - Mouse: ENSMUSG00000048154
• Gene ID - Rat: ENSRNOG00000061499
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.