Anti C3orf14 pAb (ATL-HPA048286)

Atlas Antibodies

SKU: ATL-HPA048286-25

• 
• 

Protein Description: chromosome 3 open reading frame 14
Gene Name: C3orf14
Alternative Gene Name: HT021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033111: 71%, ENSRNOG00000039871: 71%
Entrez Gene ID: 57415
Uniprot ID: Q9HBI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSL
• Gene Sequence: LFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSL
• Gene ID - Mouse: ENSMUSG00000033111
• Gene ID - Rat: ENSRNOG00000039871
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.