Anti C2orf88 pAb (ATL-HPA049549 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049549-25

• 
• 

Protein Description: chromosome 2 open reading frame 88
Gene Name: C2orf88
Alternative Gene Name: MGC13057, smAKAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043629: 48%, ENSRNOG00000038738: 51%
Entrez Gene ID: 84281
Uniprot ID: Q9BSF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDILCDA
• Gene Sequence: MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDILCDA
• Gene ID - Mouse: ENSMUSG00000043629
• Gene ID - Rat: ENSRNOG00000038738
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.