Anti C2orf76 pAb (ATL-HPA055362)

Atlas Antibodies

SKU: ATL-HPA055362-25

• 

Protein Description: chromosome 2 open reading frame 76
Gene Name: C2orf76
Alternative Gene Name: AIM29, LOC130355, MGC104437
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026388: 80%, ENSRNOG00000045570: 78%
Entrez Gene ID: 130355
Uniprot ID: Q3KRA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSW
• Gene Sequence: DALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSW
• Gene ID - Mouse: ENSMUSG00000026388
• Gene ID - Rat: ENSRNOG00000045570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.