Anti C2orf72 pAb (ATL-HPA044962)

Atlas Antibodies

SKU:
ATL-HPA044962-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & plasma membrane.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line CACO-2
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 72
Gene Name: C2orf72
Alternative Gene Name: LOC257407
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026227: 60%, ENSRNOG00000017557: 65%
Entrez Gene ID: 257407
Uniprot ID: A6NCS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQPVEGAWERPGLPGLLACFSWGPWSRRKNQDVAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKACDGVVHTPAEP
Gene Sequence GQPVEGAWERPGLPGLLACFSWGPWSRRKNQDVAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKACDGVVHTPAEP
Gene ID - Mouse ENSMUSG00000026227
Gene ID - Rat ENSRNOG00000017557
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C2orf72 pAb (ATL-HPA044962)
Datasheet Anti C2orf72 pAb (ATL-HPA044962) Datasheet (External Link)
Vendor Page Anti C2orf72 pAb (ATL-HPA044962) at Atlas Antibodies

Documents & Links for Anti C2orf72 pAb (ATL-HPA044962)
Datasheet Anti C2orf72 pAb (ATL-HPA044962) Datasheet (External Link)
Vendor Page Anti C2orf72 pAb (ATL-HPA044962)