Anti C2orf69 pAb (ATL-HPA045225)

Atlas Antibodies

SKU: ATL-HPA045225-25

• 
• 

Protein Description: chromosome 2 open reading frame 69
Gene Name: C2orf69
Alternative Gene Name: FLJ38973
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038323: 96%, ENSRNOG00000010185: 96%
Entrez Gene ID: 205327
Uniprot ID: Q8N8R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEH
• Gene Sequence: QHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEH
• Gene ID - Mouse: ENSMUSG00000038323
• Gene ID - Rat: ENSRNOG00000010185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.