Anti C2orf16 pAb (ATL-HPA056962)

Atlas Antibodies

Catalog No.: ATL-HPA056962-25

Protein Description: chromosome 2 open reading frame 16
Gene Name: C2orf16
Alternative Gene Name: DKFZp434G118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044581: 34%, ENSRNOG00000013844: 26%
Entrez Gene ID: 84226
Uniprot ID: Q68DN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEETYIDPTMIQSLTFPLALHNQSSDKTANIVENPCPEILGVDVISKETTKRKQMEELENSLQRHLPQSWRSRSRTFQAESGVQKG
• Gene Sequence: PEETYIDPTMIQSLTFPLALHNQSSDKTANIVENPCPEILGVDVISKETTKRKQMEELENSLQRHLPQSWRSRSRTFQAESGVQKG
• Gene ID - Mouse: ENSMUSG00000044581
• Gene ID - Rat: ENSRNOG00000013844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.