Anti C2CD5 pAb (ATL-HPA046194)

Atlas Antibodies

SKU: ATL-HPA046194-25

• 
• 

Protein Description: C2 calcium-dependent domain containing 5
Gene Name: C2CD5
Alternative Gene Name: CDP138, KIAA0528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030279: 95%, ENSRNOG00000014382: 91%
Entrez Gene ID: 9847
Uniprot ID: Q86YS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSICEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFC
• Gene Sequence: IHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSICEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFC
• Gene ID - Mouse: ENSMUSG00000030279
• Gene ID - Rat: ENSRNOG00000014382
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.