Anti C22orf46 pAb (ATL-HPA052741)

Atlas Antibodies

SKU:
ATL-HPA052741-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 22 open reading frame 46
Gene Name: C22orf46
Alternative Gene Name: CTA-216E10.6, FLJ23584
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075524: 57%, ENSRNOG00000030150: 56%
Entrez Gene ID: 79640
Uniprot ID: C9J442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVISVRSRPTSMTLTTSLPNL
Gene Sequence VHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVISVRSRPTSMTLTTSLPNL
Gene ID - Mouse ENSMUSG00000075524
Gene ID - Rat ENSRNOG00000030150
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C22orf46 pAb (ATL-HPA052741)
Datasheet Anti C22orf46 pAb (ATL-HPA052741) Datasheet (External Link)
Vendor Page Anti C22orf46 pAb (ATL-HPA052741) at Atlas Antibodies

Documents & Links for Anti C22orf46 pAb (ATL-HPA052741)
Datasheet Anti C22orf46 pAb (ATL-HPA052741) Datasheet (External Link)
Vendor Page Anti C22orf46 pAb (ATL-HPA052741)