Anti C21orf91 pAb (ATL-HPA049030)

Atlas Antibodies

SKU: ATL-HPA049030-25

• 

Protein Description: chromosome 21 open reading frame 91
Gene Name: C21orf91
Alternative Gene Name: C21orf14, C21orf38, CSSG1, EURL, YG81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022864: 91%, ENSRNOG00000001554: 94%
Entrez Gene ID: 54149
Uniprot ID: Q9NYK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIANQGCPRSKLS
• Gene Sequence: EEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIANQGCPRSKLS
• Gene ID - Mouse: ENSMUSG00000022864
• Gene ID - Rat: ENSRNOG00000001554
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C21orf91 pAb (ATL-HPA049030) – 1 Found

Reiche, Laura; Göttle, Peter; Lane, Lydie; Duek, Paula; Park, Mina; Azim, Kasum; Schütte, Jana; Manousi, Anastasia; Schira-Heinen, Jessica; Küry, Patrick. C21orf91 Regulates Oligodendroglial Precursor Cell Fate-A Switch in the Glial Lineage?. Frontiers In Cellular Neuroscience. 15( 33796011):653075.