Anti C1QTNF7 pAb (ATL-HPA051797)

Atlas Antibodies

SKU: ATL-HPA051797-25

• 

Protein Description: C1q and tumor necrosis factor related protein 7
Gene Name: C1QTNF7
Alternative Gene Name: CTRP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061535: 98%, ENSRNOG00000005094: 98%
Entrez Gene ID: 114905
Uniprot ID: Q9BXJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL
• Gene Sequence: GSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL
• Gene ID - Mouse: ENSMUSG00000061535
• Gene ID - Rat: ENSRNOG00000005094
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.