Anti C1QB pAb (ATL-HPA052116)

Atlas Antibodies

SKU: ATL-HPA052116-25

• 

Protein Description: complement component 1, q subcomponent, B chain
Gene Name: C1QB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036905: 77%, ENSRNOG00000012749: 77%
Entrez Gene ID: 713
Uniprot ID: P02746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKV
• Gene Sequence: PKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKV
• Gene ID - Mouse: ENSMUSG00000036905
• Gene ID - Rat: ENSRNOG00000012749
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.