Anti C1orf68 pAb (ATL-HPA057942)

Atlas Antibodies

SKU: ATL-HPA057942-25

• 

Protein Description: chromosome 1 open reading frame 68
Gene Name: C1orf68
Alternative Gene Name: LEP7, XP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090314: 63%, ENSRNOG00000023511: 62%
Entrez Gene ID: 100129271
Uniprot ID: Q5T750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVT
• Gene Sequence: CQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVT
• Gene ID - Mouse: ENSMUSG00000090314
• Gene ID - Rat: ENSRNOG00000023511
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.