Anti C1orf226 pAb (ATL-HPA052251)

Atlas Antibodies

SKU: ATL-HPA052251-25

• 
• 

Protein Description: chromosome 1 open reading frame 226
Gene Name: C1orf226
Alternative Gene Name: FLJ13137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102752: 84%, ENSRNOG00000042929: 81%
Entrez Gene ID: 400793
Uniprot ID: A1L170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFLRRKEPSSLGSVGVTEINKTAGAQLASGTDAAPEAWLEDERSVLQETFPRLDPPPPITRKRTPRALKTTQD
• Gene Sequence: DFLRRKEPSSLGSVGVTEINKTAGAQLASGTDAAPEAWLEDERSVLQETFPRLDPPPPITRKRTPRALKTTQD
• Gene ID - Mouse: ENSMUSG00000102752
• Gene ID - Rat: ENSRNOG00000042929
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.