Anti C1orf204 pAb (ATL-HPA045602)

Atlas Antibodies

SKU: ATL-HPA045602-25

• 

Protein Description: chromosome 1 open reading frame 204
Gene Name: C1orf204
Alternative Gene Name: FLJ39187
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031661: 29%, ENSRNOG00000014293: 31%
Entrez Gene ID: 284677
Uniprot ID: Q5VU13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVT
• Gene Sequence: GLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVT
• Gene ID - Mouse: ENSMUSG00000031661
• Gene ID - Rat: ENSRNOG00000014293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.