Anti C1orf189 pAb (ATL-HPA045779)

Atlas Antibodies

SKU:
ATL-HPA045779-25
  • Immunohistochemical staining of human fallopian tube shows moderate positivity in ciliated cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 189
Gene Name: C1orf189
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027942: 74%, ENSRNOG00000037406: 78%
Entrez Gene ID: 388701
Uniprot ID: Q5VU69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEESFQKAMGLKKTVDRWRNSHTHCLWQMALGQRRNPYATLRMQDTMVQELALAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKA
Gene Sequence VEESFQKAMGLKKTVDRWRNSHTHCLWQMALGQRRNPYATLRMQDTMVQELALAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKA
Gene ID - Mouse ENSMUSG00000027942
Gene ID - Rat ENSRNOG00000037406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1orf189 pAb (ATL-HPA045779)
Datasheet Anti C1orf189 pAb (ATL-HPA045779) Datasheet (External Link)
Vendor Page Anti C1orf189 pAb (ATL-HPA045779) at Atlas Antibodies

Documents & Links for Anti C1orf189 pAb (ATL-HPA045779)
Datasheet Anti C1orf189 pAb (ATL-HPA045779) Datasheet (External Link)
Vendor Page Anti C1orf189 pAb (ATL-HPA045779)