Anti C1orf145 pAb (ATL-HPA046612)

Atlas Antibodies

SKU:
ATL-HPA046612-25
  • Immunohistochemical staining of human rectum shows strong nuclear membrane positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 145
Gene Name: C1orf145
Alternative Gene Name: FLJ31994
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030779: 28%, ENSRNOG00000014530: 28%
Entrez Gene ID:
Uniprot ID: Q96MR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARREDWNG
Gene Sequence MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARREDWNG
Gene ID - Mouse ENSMUSG00000030779
Gene ID - Rat ENSRNOG00000014530
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1orf145 pAb (ATL-HPA046612)
Datasheet Anti C1orf145 pAb (ATL-HPA046612) Datasheet (External Link)
Vendor Page Anti C1orf145 pAb (ATL-HPA046612) at Atlas Antibodies

Documents & Links for Anti C1orf145 pAb (ATL-HPA046612)
Datasheet Anti C1orf145 pAb (ATL-HPA046612) Datasheet (External Link)
Vendor Page Anti C1orf145 pAb (ATL-HPA046612)