Anti C19orf81 pAb (ATL-HPA060238 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060238-25

• 
• 

Protein Description: chromosome 19 open reading frame 81
Gene Name: C19orf81
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008028: 84%, ENSRNOG00000047306: 28%
Entrez Gene ID: 342918
Uniprot ID: C9J6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNRWLIAVTDFQTRSRLLRSGLSPRGLAHQIVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPNEEA
• Gene Sequence: RNRWLIAVTDFQTRSRLLRSGLSPRGLAHQIVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPNEEA
• Gene ID - Mouse: ENSMUSG00000008028
• Gene ID - Rat: ENSRNOG00000047306
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.