Anti C19orf57 pAb (ATL-HPA054615)

Atlas Antibodies

SKU:
ATL-HPA054615-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 57
Gene Name: C19orf57
Alternative Gene Name: MGC11271
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008129: 32%, ENSRNOG00000026415: 32%
Entrez Gene ID: 79173
Uniprot ID: Q0VDD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPTELEERALEVAGPDGQASAISPASPRRKAADGGHRRALPGCTSLTGETTGESGEAGQDGKPPGDVLVGPTASLALAPGSGESMMGAGDSGHASPD
Gene Sequence DPTELEERALEVAGPDGQASAISPASPRRKAADGGHRRALPGCTSLTGETTGESGEAGQDGKPPGDVLVGPTASLALAPGSGESMMGAGDSGHASPD
Gene ID - Mouse ENSMUSG00000008129
Gene ID - Rat ENSRNOG00000026415
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C19orf57 pAb (ATL-HPA054615)
Datasheet Anti C19orf57 pAb (ATL-HPA054615) Datasheet (External Link)
Vendor Page Anti C19orf57 pAb (ATL-HPA054615) at Atlas Antibodies

Documents & Links for Anti C19orf57 pAb (ATL-HPA054615)
Datasheet Anti C19orf57 pAb (ATL-HPA054615) Datasheet (External Link)
Vendor Page Anti C19orf57 pAb (ATL-HPA054615)