Anti C19orf54 pAb (ATL-HPA059628)

Atlas Antibodies

SKU: ATL-HPA059628-25

• 

Protein Description: chromosome 19 open reading frame 54
Gene Name: C19orf54
Alternative Gene Name: FLJ41131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078786: 83%, ENSRNOG00000037715: 83%
Entrez Gene ID: 284325
Uniprot ID: Q5BKX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLVTGHPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLP
• Gene Sequence: HLVTGHPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLP
• Gene ID - Mouse: ENSMUSG00000078786
• Gene ID - Rat: ENSRNOG00000037715
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.