Anti C19orf43 pAb (ATL-HPA059965 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA059965-25
  • Immunohistochemistry analysis in human epididymis and pancreas tissues using HPA059965 antibody. Corresponding C19orf43 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line MCF-7
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 43
Gene Name: C19orf43
Alternative Gene Name: fSAP18, MGC2803
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041203: 98%, ENSRNOG00000003863: 97%
Entrez Gene ID: 79002
Uniprot ID: Q9BQ61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSTLSFVGKRRGGNKLALKTGIVAKKQKTEDEVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTR
Gene Sequence GSTLSFVGKRRGGNKLALKTGIVAKKQKTEDEVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTR
Gene ID - Mouse ENSMUSG00000041203
Gene ID - Rat ENSRNOG00000003863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C19orf43 pAb (ATL-HPA059965 w/enhanced validation)
Datasheet Anti C19orf43 pAb (ATL-HPA059965 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C19orf43 pAb (ATL-HPA059965 w/enhanced validation)