Anti C19orf25 pAb (ATL-HPA050270)

Atlas Antibodies

SKU: ATL-HPA050270-100

• 
• 

Protein Description: chromosome 19 open reading frame 25
Gene Name: C19orf25
Alternative Gene Name: FLJ36666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020133: 45%, ENSRNOG00000016399: 43%
Entrez Gene ID: 148223
Uniprot ID: Q9UFG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG
• Gene Sequence: GEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG
• Gene ID - Mouse: ENSMUSG00000020133
• Gene ID - Rat: ENSRNOG00000016399
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.