Anti C19orf24 pAb (ATL-HPA047026 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047026-25

• 
• 

Protein Description: chromosome 19 open reading frame 24
Gene Name: C19orf24
Alternative Gene Name: FLJ20640
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070808: 27%, ENSRNOG00000010617: 28%
Entrez Gene ID: 55009
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGPCSLASWMLSQPGRGSQVKTGGTPTATAQDAEAPLPDCDLCLSPAPVGTWQPRAKAGWAGDPRNLSGNTFSP
• Gene Sequence: AGPCSLASWMLSQPGRGSQVKTGGTPTATAQDAEAPLPDCDLCLSPAPVGTWQPRAKAGWAGDPRNLSGNTFSP
• Gene ID - Mouse: ENSMUSG00000070808
• Gene ID - Rat: ENSRNOG00000010617
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.