Anti C19orf18 pAb (ATL-HPA079195)

Atlas Antibodies

SKU: ATL-HPA079195-25

• 

Product Description

Protein Description: chromosome 19 open reading frame 18
Gene Name: C19orf18
Alternative Gene Name: MGC41906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 33%, ENSRNOG00000022325: 33%
Entrez Gene ID: 147685
Uniprot ID: Q8NEA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEGESTHLLPENENELEKFIHSVIISKRSKNIKKKLKEEQNSVTENKTKNASHNGKMEDL
• Gene Sequence: DEGESTHLLPENENELEKFIHSVIISKRSKNIKKKLKEEQNSVTENKTKNASHNGKMEDL
• Gene ID - Mouse: ENSMUSG00000028312
• Gene ID - Rat: ENSRNOG00000022325
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links