Anti C19orf18 pAb (ATL-HPA079195)
Atlas Antibodies
- SKU:
- ATL-HPA079195-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: chromosome 19 open reading frame 18
Gene Name: C19orf18
Alternative Gene Name: MGC41906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 33%, ENSRNOG00000022325: 33%
Entrez Gene ID: 147685
Uniprot ID: Q8NEA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C19orf18
Alternative Gene Name: MGC41906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 33%, ENSRNOG00000022325: 33%
Entrez Gene ID: 147685
Uniprot ID: Q8NEA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEGESTHLLPENENELEKFIHSVIISKRSKNIKKKLKEEQNSVTENKTKNASHNGKMEDL |
Gene Sequence | DEGESTHLLPENENELEKFIHSVIISKRSKNIKKKLKEEQNSVTENKTKNASHNGKMEDL |
Gene ID - Mouse | ENSMUSG00000028312 |
Gene ID - Rat | ENSRNOG00000022325 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C19orf18 pAb (ATL-HPA079195) | |
Datasheet | Anti C19orf18 pAb (ATL-HPA079195) Datasheet (External Link) |
Vendor Page | Anti C19orf18 pAb (ATL-HPA079195) at Atlas Antibodies |
Documents & Links for Anti C19orf18 pAb (ATL-HPA079195) | |
Datasheet | Anti C19orf18 pAb (ATL-HPA079195) Datasheet (External Link) |
Vendor Page | Anti C19orf18 pAb (ATL-HPA079195) |