Protein Description: chromosome 19 open reading frame 18
Gene Name: C19orf18
Alternative Gene Name: MGC41906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 33%, ENSRNOG00000022325: 33%
Entrez Gene ID: 147685
Uniprot ID: Q8NEA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C19orf18
Alternative Gene Name: MGC41906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 33%, ENSRNOG00000022325: 33%
Entrez Gene ID: 147685
Uniprot ID: Q8NEA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DEGESTHLLPENENELEKFIHSVIISKRSKNIKKKLKEEQNSVTENKTKNASHNGKMEDL |
| Documents & Links for Anti C19orf18 pAb (ATL-HPA079195) | |
| Datasheet | Anti C19orf18 pAb (ATL-HPA079195) Datasheet (External Link) |
| Vendor Page | Anti C19orf18 pAb (ATL-HPA079195) at Atlas |
| Documents & Links for Anti C19orf18 pAb (ATL-HPA079195) | |
| Datasheet | Anti C19orf18 pAb (ATL-HPA079195) Datasheet (External Link) |
| Vendor Page | Anti C19orf18 pAb (ATL-HPA079195) |