Anti C19orf12 pAb (ATL-HPA046930)

Atlas Antibodies

SKU: ATL-HPA046930-25

• 

Protein Description: chromosome 19 open reading frame 12
Gene Name: C19orf12
Alternative Gene Name: DKFZP762D096, MGC10922, NBIA4, SPG43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054676: 79%, ENSRNOG00000014966: 82%
Entrez Gene ID: 83636
Uniprot ID: Q9NSK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQ
• Gene Sequence: GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQ
• Gene ID - Mouse: ENSMUSG00000054676
• Gene ID - Rat: ENSRNOG00000014966
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.