Anti C17orf62 pAb (ATL-HPA045696)

Atlas Antibodies

SKU: ATL-HPA045696-25

• 
• 

Protein Description: chromosome 17 open reading frame 62
Gene Name: C17orf62
Alternative Gene Name: FLJ90469, MGC4368
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039294: 84%, ENSRNOG00000036666: 84%
Entrez Gene ID: 79415
Uniprot ID: Q9BQA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS
• Gene Sequence: MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS
• Gene ID - Mouse: ENSMUSG00000039294
• Gene ID - Rat: ENSRNOG00000036666
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C17orf62 pAb (ATL-HPA045696) – 1 Found

Arnadottir, Gudny A; Norddahl, Gudmundur L; Gudmundsdottir, Steinunn; Agustsdottir, Arna B; Sigurdsson, Snaevar; Jensson, Brynjar O; Bjarnadottir, Kristbjorg; Theodors, Fannar; Benonisdottir, Stefania; Ivarsdottir, Erna V; Oddsson, Asmundur; Kristjansson, Ragnar P; Sulem, Gerald; Alexandersson, Kristjan F; Juliusdottir, Thorhildur; Gudmundsson, Kjartan R; Saemundsdottir, Jona; Jonasdottir, Adalbjorg; Jonasdottir, Aslaug; Sigurdsson, Asgeir; Manzanillo, Paolo; Gudjonsson, Sigurjon A; Thorisson, Gudmundur A; Magnusson, Olafur Th; Masson, Gisli; Orvar, Kjartan B; Holm, Hilma; Bjornsson, Sigurdur; Arngrimsson, Reynir; Gudbjartsson, Daniel F; Thorsteinsdottir, Unnur; Jonsdottir, Ingileif; Haraldsson, Asgeir; Sulem, Patrick; Stefansson, Kari. A homozygous loss-of-function mutation leading to CYBC1 deficiency causes chronic granulomatous disease. Nature Communications. 2018;9(1):4447.