Anti C17orf51 pAb (ATL-HPA052106 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052106-25

• 
• 

Protein Description: chromosome 17 open reading frame 51
Gene Name: C17orf51
Alternative Gene Name: FLJ12977, FLJ31874, FLJ33618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008540: 25%, ENSRNOG00000009932: 29%
Entrez Gene ID: 339263
Uniprot ID: A8MQB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALYAPALRLRDHLDRFSILMTSCTSWLQAPQAPGLCRDEQSSRISVPQLSGAPILLPDLEGTKLSNFQE
• Gene Sequence: ALYAPALRLRDHLDRFSILMTSCTSWLQAPQAPGLCRDEQSSRISVPQLSGAPILLPDLEGTKLSNFQE
• Gene ID - Mouse: ENSMUSG00000008540
• Gene ID - Rat: ENSRNOG00000009932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.