Protein Description: chromosome 17 open reading frame 107
Gene Name: C17orf107
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087279: 67%, ENSRNOG00000042847: 67%
Entrez Gene ID: 100130311
Uniprot ID: Q6ZR85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C17orf107
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087279: 67%, ENSRNOG00000042847: 67%
Entrez Gene ID: 100130311
Uniprot ID: Q6ZR85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SARLLVQGAWLCLCGRGLQGSASFLRQSQQQLGLGIPGEPVSSGH |
| Documents & Links for Anti C17orf107 pAb (ATL-HPA069713) | |
| Datasheet | Anti C17orf107 pAb (ATL-HPA069713) Datasheet (External Link) |
| Vendor Page | Anti C17orf107 pAb (ATL-HPA069713) at Atlas |
| Documents & Links for Anti C17orf107 pAb (ATL-HPA069713) | |
| Datasheet | Anti C17orf107 pAb (ATL-HPA069713) Datasheet (External Link) |
| Vendor Page | Anti C17orf107 pAb (ATL-HPA069713) |