Anti C17orf107 pAb (ATL-HPA069713)

Atlas Antibodies

SKU: ATL-HPA069713-25

• 
• 

Protein Description: chromosome 17 open reading frame 107
Gene Name: C17orf107
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087279: 67%, ENSRNOG00000042847: 67%
Entrez Gene ID: 100130311
Uniprot ID: Q6ZR85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SARLLVQGAWLCLCGRGLQGSASFLRQSQQQLGLGIPGEPVSSGH
• Gene Sequence: SARLLVQGAWLCLCGRGLQGSASFLRQSQQQLGLGIPGEPVSSGH
• Gene ID - Mouse: ENSMUSG00000087279
• Gene ID - Rat: ENSRNOG00000042847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.