Anti C17orf100 pAb (ATL-HPA046824)

Atlas Antibodies

SKU:
ATL-HPA046824-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 100
Gene Name: C17orf100
Alternative Gene Name: LOC388327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025272: 33%, ENSRNOG00000014865: 60%
Entrez Gene ID: 388327
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSSPRVGTTRYTETSTVRVETSSHRVETSSRRVETSQRRSEGPSLSPSGKRLPRILEASSRHVESSSQRTETTS
Gene Sequence QSSPRVGTTRYTETSTVRVETSSHRVETSSRRVETSQRRSEGPSLSPSGKRLPRILEASSRHVESSSQRTETTS
Gene ID - Mouse ENSMUSG00000025272
Gene ID - Rat ENSRNOG00000014865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C17orf100 pAb (ATL-HPA046824)
Datasheet Anti C17orf100 pAb (ATL-HPA046824) Datasheet (External Link)
Vendor Page Anti C17orf100 pAb (ATL-HPA046824) at Atlas Antibodies

Documents & Links for Anti C17orf100 pAb (ATL-HPA046824)
Datasheet Anti C17orf100 pAb (ATL-HPA046824) Datasheet (External Link)
Vendor Page Anti C17orf100 pAb (ATL-HPA046824)