Anti C16orf74 pAb (ATL-HPA049367)

Atlas Antibodies

SKU: ATL-HPA049367-25

• 
• 

Protein Description: chromosome 16 open reading frame 74
Gene Name: C16orf74
Alternative Gene Name: MGC17624
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097919: 71%, ENSRNOG00000017646: 71%
Entrez Gene ID: 404550
Uniprot ID: Q96GX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDP
• Gene Sequence: PVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDP
• Gene ID - Mouse: ENSMUSG00000097919
• Gene ID - Rat: ENSRNOG00000017646
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.