Protein Description: chromosome 16 open reading frame 72
Gene Name: C16orf72
Alternative Gene Name: FLJ41272, PRO0149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022507: 97%, ENSRNOG00000002545: 97%
Entrez Gene ID: 29035
Uniprot ID: Q14CZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C16orf72
Alternative Gene Name: FLJ41272, PRO0149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022507: 97%, ENSRNOG00000002545: 97%
Entrez Gene ID: 29035
Uniprot ID: Q14CZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPT |
| Documents & Links for Anti C16orf72 pAb (ATL-HPA067492) | |
| Datasheet | Anti C16orf72 pAb (ATL-HPA067492) Datasheet (External Link) |
| Vendor Page | Anti C16orf72 pAb (ATL-HPA067492) at Atlas |
| Documents & Links for Anti C16orf72 pAb (ATL-HPA067492) | |
| Datasheet | Anti C16orf72 pAb (ATL-HPA067492) Datasheet (External Link) |
| Vendor Page | Anti C16orf72 pAb (ATL-HPA067492) |