Anti C16orf72 pAb (ATL-HPA067492)

Atlas Antibodies

SKU: ATL-HPA067492-25

• 

Protein Description: chromosome 16 open reading frame 72
Gene Name: C16orf72
Alternative Gene Name: FLJ41272, PRO0149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022507: 97%, ENSRNOG00000002545: 97%
Entrez Gene ID: 29035
Uniprot ID: Q14CZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPT
• Gene Sequence: VRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPT
• Gene ID - Mouse: ENSMUSG00000022507
• Gene ID - Rat: ENSRNOG00000002545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.