Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049468-25

• 
• 

Protein Description: chromosome 16 open reading frame 71
Gene Name: C16orf71
Alternative Gene Name: DKFZp686H2240, FLJ43261
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042010: 29%, ENSRNOG00000028075: 63%
Entrez Gene ID: 146562
Uniprot ID: Q8IYS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASNDKGMAPSLGSPWASQMGPWDAILKAVKDQLPSLDSDSPLSDYGEEELFIFQRNQTSLIPDLSEELAEDPADG
• Gene Sequence: MASNDKGMAPSLGSPWASQMGPWDAILKAVKDQLPSLDSDSPLSDYGEEELFIFQRNQTSLIPDLSEELAEDPADG
• Gene ID - Mouse: ENSMUSG00000042010
• Gene ID - Rat: ENSRNOG00000028075
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) – 2 Found

Lee, Chanjae; Cox, Rachael M; Papoulas, Ophelia; Horani, Amjad; Drew, Kevin; Devitt, Caitlin C; Brody, Steven L; Marcotte, Edward M; Wallingford, John B. Functional partitioning of a liquid-like organelle during assembly of axonemal dyneins. Elife. 2020;9( 33263282) 

Mateos-Quiros, Clara Maria; Garrido-Jimenez, Sergio; Álvarez-Hernán, Guadalupe; Diaz-Chamorro, Selene; Barrera-Lopez, Juan Francisco; Francisco-Morcillo, Javier; Roman, Angel Carlos; Centeno, Francisco; Carvajal-Gonzalez, Jose Maria. Junctional Adhesion Molecule 3 Expression in the Mouse Airway Epithelium Is Linked to Multiciliated Cells. Frontiers In Cell And Developmental Biology. 9( 34395412):622515.