Anti C16orf59 pAb (ATL-HPA055389)

Atlas Antibodies

SKU: ATL-HPA055389-25

• 

Protein Description: chromosome 16 open reading frame 59
Gene Name: C16orf59
Alternative Gene Name: FLJ13909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024118: 45%, ENSRNOG00000007436: 54%
Entrez Gene ID: 80178
Uniprot ID: Q7L2K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAKGHPERRLLSVGDGTRVGM
• Gene Sequence: EKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAKGHPERRLLSVGDGTRVGM
• Gene ID - Mouse: ENSMUSG00000024118
• Gene ID - Rat: ENSRNOG00000007436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.