Anti C14orf28 pAb (ATL-HPA059635)

Atlas Antibodies

SKU: ATL-HPA059635-25

• 

Protein Description: chromosome 14 open reading frame 28
Gene Name: C14orf28
Alternative Gene Name: DRIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047227: 92%, ENSRNOG00000023230: 89%
Entrez Gene ID: 122525
Uniprot ID: Q4W4Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCH
• Gene Sequence: LMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCH
• Gene ID - Mouse: ENSMUSG00000047227
• Gene ID - Rat: ENSRNOG00000023230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.